| Desktop | 67/100 | ❗ |
| Mobile | 25/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 44 KB | ✔ |
| Compression | NO | ✘ |
| Text/Html Ratio | 3022 / 45502 (bytes) = 6.64% | ❗ |
| Load Time | 2.55 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 12 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 1 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | Yes | ✘ |
| Iframe | Yes | ✘ |
| Custom 404 page | No | ✘ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| pharmacy | 9 | ✔ | ✔ | ✔ |
| specialty | 9 | ✔ | ✔ | ✔ |
| pacific | 7 | ✔ | ✔ | ✔ |
| main | 4 | ✘ | ✘ | ✘ |
| compounding | 3 | ✘ | ✔ | ✔ |
| about | 2 | ✘ | ✘ | ✔ |
| state-of-the-art | 2 | ✘ | ✘ | ✘ |
| medications | 2 | ✘ | ✘ | ✔ |
| pets | 2 | ✘ | ✔ | ✘ |
| transfer | 2 | ✘ | ✘ | ✔ |
| contact | 2 | ✘ | ✘ | ✘ |
| family | 2 | ✘ | ✘ | ✘ |
| look | 1 | ✘ | ✘ | ✘ |
| being | 1 | ✘ | ✘ | ✘ |
| addressphone | 1 | ✘ | ✘ | ✘ |
|
With 2.55 seconds in page load, 44 KB of page size and all other reports below, the pacificnwspecialtypharmacy.com has a SEO score of 57 out of 100 |
| Title | Pharmacy in Vancouver, WA | Pharmacy Near Me | Pacific NW Specialty Pharmacy |
| Description | Pacific NW Specialty Pharmacy is a pharmacy near me that offers all of the best services in compounding and prescriptions for humans and their pets. |
| Keyword |
| Age | 0 Years, 3 Days |
| Created | 22nd-Jun-2020 |
| Updated | 22nd-Jun-2020 |
| Expiry | 22nd-Jun-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
|
IP Address: 159.89.175.74 Maximum Daily connection limit reached. Lookup refused. |
| Server IP | 199.96.172.45 |
| Server Location | United States |
| Service Provider | ECR Internet Services |
| Domains (TLD) | Status |
|---|---|
| pacificnwspecialtypharmacy.net | Available |
| pacificnwspecialtypharmacy.org | Available |
| pacificnwspecialtypharmacy.biz | Already Registered |
| pacificnwspecialtypharmacy.io | Already Registered |
| pacificnwspecialtypharmacy.info | Available |
| Domains (TLD) | Status |
|---|---|
| oacificnwspecialtypharmacy.com | Available |
| lacificnwspecialtypharmacy.com | Available |
| pqcificnwspecialtypharmacy.com | Available |
| pwcificnwspecialtypharmacy.com | Available |
| pzcificnwspecialtypharmacy.com | Available |
| Dxshiping.com |
| Emmarealtor.com |
| Yantarik.com |
| Interactivefalcon.com |
| Proetancheite.com |
| Chillhometw.com |
| 76southbelt.com |
| Boxberry.network |
| Timesmalang.com |
| Bzxljx.com |